PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00209.1.g00400.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 347aa    MW: 35807.2 Da    PI: 9.2019
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00209.1.g00400.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.23.1e-3784142361
                        zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                                   e  lkcprCdstntkfCy+nnyslsqPr+fC+aCrryWt+GGalrnvPvGgg r++ k+
  Zjn_sc00209.1.g00400.1.sm.mk  84 EPGLKCPRCDSTNTKFCYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAKR 142
                                   56789************************************************998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3867139IPR003851Zinc finger, Dof-type
PfamPF027017.1E-3287141IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.78987141IPR003851Zinc finger, Dof-type
PROSITE patternPS01361089125IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MIFSPAFLDS SSWNDNQQQQ QAHHQQVVAS TGDGTSHEQL LQPSIMGGGA LPPEGGGTAQ  60
VVVGPAKPMS MSERARLARI PLPEPGLKCP RCDSTNTKFC YFNNYSLSQP RHFCRACRRY  120
WTRGGALRNV PVGGGYRRHA KRAKPKAAAA AAATPVTTAA ATAVLAPGAA AGSTLSTCTT  180
VNAPALSGQT AMLGGGNLSM LPPLLRLADF DAMSLGSSFT GIGKPTLEAV GNYSIGGASG  240
GAGAGAGLDQ WRLHQQMQGF PFLHAMDQGS LAPSLAMVMP GAFQLGLDNT DSRGAGTGGG  300
EDGSGEINGM APTKREGGYT RGMYGAHHHF TAGYTTSYSN ATGNHLL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0793561e-105AC079356.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone P0016H04, complete sequence.
GenBankAK1089331e-105AK108933.1 Oryza sativa Japonica Group cDNA clone:002-153-A09, full insert sequence.
GenBankAP0149611e-105AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBankGQ1835521e-105GQ183552.1 Oryza sativa Japonica Group Dof-type zinc finger protein 25 gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012700432.11e-115PREDICTED: dof zinc finger protein DOF3.6-like isoform X3
TrEMBLA0A0A9CTK51e-127A0A0A9CTK5_ARUDO; Uncharacterized protein
STRINGSi022547m1e-113(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.11e-43OBF-binding protein 3